Rat Secondary Antibodies
ABclonal Technology APC Rat anti-Mouse TER-119 mAb
TER-119 is a mouse erythroid lineage-specific monoclonal antibody that reacts with erythroid cells at differentiation stages from early proerythroblast to mature erythrocyte but not with cells showing typical erythroid blast-forming unit (BFU-E) and erythroid colony-forming unit (CFU-E) activities TER-119 recognizes a 52-kDa molecule on erythrocyte membranes TER-119 antigen is a molecule associated with cell-surface glycophorin A but not with glycophorin A itself
CPC Scientific H-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (trifluoroacetate salt) 1MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Cys10 and 26 bridge)MOLECULAR FORMULA: C146H239N47O44S3MOLECULAR WEIGHT:3453STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [133448-20-1], RESEARCH AREA: CardiovascularREFERENCES: M. Kojima et al., BBRC, 159, 1420 (1989)
Biotium Primary Antibody CD81 NA ExoBrite APC 1/EA
ExoBrite APC CD81 anti-mouse Flow Antibody is optimized for detection of the exosome marker CD81 in isolated exosomes by flow cytometry Recommended for instruments optimized for small particle flow 25 tests
Biotium CD86 (Dendritic Cells Maturation Marker)(C86/2160R), 0.2mg/mL
Recognizes a protein of 70 kDa, which is identified as CD86. CD86 is a type I transmembrane glycoprotein and a member of the immunoglobulin superfamily of cell surface receptors. It is expressed at high levels on resting peripheral monocytes and dendritic cells and at very low density on resting B and T lymphocytes. CD86 expression is rapidly upregulated by B cell specific stimuli with peak expression at 18 to 42 hours after stimulation. CD86, along with CD80/B71, is an important accessory molecule in T cell co-stimulation via its interaction with CD28 and CD152/CTLA4. Since CD86 has rapid kinetics of induction, it is believed to be the major CD28 ligand expressed early in the immune response. It is also found on malignant Hodgkin and Reed Sternberg (HRS) cells in Hodgkin's disease. Primary antibodies are available purified, or with a selection of fluorescent CF Dyes and other labels. CF Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent
ABclonal Technology 647 anti-Human CD90/Thy1
This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins The encoded protein is involved in cell adhesion and cell communication in numerous cell types but particularly in cells of the immune and nervous systems The encoded protein is widely used as a marker for hematopoietic stem cells This gene may function as a tumor suppressor in nasopharyngeal carcinoma Alternative splicing results in multiple transcript variants